Intermedin (human) trifluoroacetate salt,CAS : 1188922-20-4

Intermedin (human) trifluoroacetate salt

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-888	0.5mg	365.00	- +	+ Add to cart
R-M-888	1mg	600.00	- +	+ Add to cart

Product description

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	1188922-20-4
Sequence	TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH₂
Synonyms	IMD (human), hIMD, Adrenomedullin-2 (human), ADM2 (human)
Molecular Formula	C₂₁₉H₃₄₉N₆₉O₆₆S₃
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document